General Information

  • ID:  hor002984
  • Uniprot ID:  P13204
  • Protein name:  Brain natriuretic peptide 26
  • Gene name:  NPPB
  • Organism:  Bos taurus (Bovine)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  Brain and atria
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0051427 hormone receptor binding
  • GO BP:  GO:0003008 system process; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006182 cGMP biosynthetic process; GO:0006457 protein folding; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0019934 cGMP-mediated signaling; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0032991 protein-containing complex

Sequence Information

  • Sequence:  DSGCFGRRLDRIGSLSGLGCNVLRRY
  • Length:  26(104-129)
  • Propeptide:  MDPQTALSRALLLLLFLHLSLLGCRSHPVGGPGPVSELPGLQELLDRLRDRVSELQAEQLRVEPLQQGQGLEETWDSPAAAPAGFLGPHHSILRALRGPKMMRDSGCFGRRLDRIGSLSGLGCNVLRRY
  • Signal peptide:  MDPQTALSRALLLLLFLHLSLLGCRS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPR3, NPR1
  • Target Unid:  P10730, E1BN71
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 3.1 minutes; /186 seconds ( PubMed ID: 2156886 )

Structure

  • Disulfide bond:  45767
  • Structure ID:  AF-Q3EDI6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q3EDI6-F1.pdbhor002984_AF2.pdbhor002984_ESM.pdb

Physical Information

Mass: 331739 Formula: C120H200N42O36S2
Absent amino acids: AEHKMPQTW Common amino acids: GR
pI: 9.59 Basic residues: 5
Polar residues: 12 Hydrophobic residues: 7
Hydrophobicity: -26.92 Boman Index: -7014
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 86.15
Instability Index: 6269.23 Extinction Coefficient cystines: 1615
Absorbance 280nm: 64.6

Literature

  • PubMed ID:  2156886
  • Title:  NA