HORDB

ID: hor002984
Uniprot ID: P13204
Protein name: Brain natriuretic peptide 26
Gene name: NPPB
Organism: Bos taurus (Bovine)
Family: Natriuretic peptide family
Source: Animal
Expression: Brain and atria
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0051427 hormone receptor binding
GO BP: GO:0003008 system process; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006182 cGMP biosynthetic process; GO:0006457 protein folding; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0019934 cGMP-mediated signaling; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0032991 protein-containing complex

Sequence: DSGCFGRRLDRIGSLSGLGCNVLRRY
Length: 26(104-129)
Propeptide: MDPQTALSRALLLLLFLHLSLLGCRSHPVGGPGPVSELPGLQELLDRLRDRVSELQAEQLRVEPLQQGQGLEETWDSPAAAPAGFLGPHHSILRALRGPKMMRDSGCFGRRLDRIGSLSGLGCNVLRRY
Signal peptide: MDPQTALSRALLLLLFLHLSLLGCRS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: May function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion.
Mechanism: NA
Cross BBB: NA
Target: NPR3, NPR1
Target Unid: P10730, E1BN71
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: 3.1 minutes; /186 seconds ( PubMed ID: 2156886 )

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q3EDI6-F1.pdb

hor002984_AF2.pdb

hor002984_ESM.pdb

Mass:	331739	Formula:	C120H200N42O36S2
Absent amino acids:	AEHKMPQTW	Common amino acids:	GR
pI:	9.59	Basic residues:	5
Polar residues:	12	Hydrophobic residues:	7
Hydrophobicity:	-26.92	Boman Index:	-7014
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	86.15
Instability Index:	6269.23	Extinction Coefficient cystines:	1615
Absorbance 280nm:	64.6